Loading...
Statistics
Advertisement

Qkqpw.xyz

Advertisement
Conversion Technology Metas Server
Qkqpw.xyz is hosted in Hong Kong . Qkqpw.xyz doesn't use HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Iframe, Number of used javascripts: 4. First javascripts: Jquery.min.js, Common.js, Check.js, Number of used analytics tools: 0. Its server type is: NetBox Version 2.8 Build 4128.

Technologies in use by Qkqpw.xyz

Technology

Number of occurences: 4
  • CSS
  • Html
  • Iframe
  • Javascript

Advertisement

Javascripts

Number of occurences: 4
  • jquery.min.js
  • common.js
  • check.js
  • check_password.js

Server Type

  • NetBox Version 2.8 Build 4128

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Qkqpw.xyz

Missing HTTPS protocol.

    Meta - Qkqpw.xyz

    Number of occurences: 1
    • Name:
      Content: IE=EmulateIE7

    Server / Hosting

    • IP: 47.90.61.161
    • Latitude: 22.25
    • Longitude: 114.17
    • Country: Hong Kong

    Rname

    • ns2.eedns.com
    • ns1.eedns.com

    Target

    • domainadmin.eedns.com

    HTTP Header Response

    HTTP/1.1 302 Found Server: NetBox Version 2.8 Build 4128 Date: Sat, 15 Oct 2016 03:31:59 GMT Set-Cookie: QYGQUHREGUGHYMHSBIFO=BAISSTIBCPHFIOVKZWTEYXVDTXSFEMBKRJPZDHIN; path=/ Location: index_f.asp Cache-Control: private Content-Type: text/html Content-Length: 0 X-Cache: MISS from s_wx1202 Via: 1.1 s_wx1202 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Server: NetBox Version 2.8 Build 4128 Date: Sat, 15 Oct 2016 03:32:00 GMT Set-Cookie: QYGQUHREGUGHYMHSBIFO=NKIERVQDCLAVMPDYNICVRHFLSFGRSILJDANLHFLF; path=/ Cache-Control: private Content-Type: text/html Content-Length: 9601 X-Cache: MISS from s_wx1202 Via: 1.1 s_wx1202 (squid/3.5.20) Connection: keep-alive

    DNS

    host: qkqpw.xyz
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 47.90.61.161
    host: qkqpw.xyz
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns2.eedns.com
    host: qkqpw.xyz
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns1.eedns.com
    host: qkqpw.xyz
    1. class: IN
    2. ttl: 7200
    3. type: SOA
    4. mname: ns1.eedns.com
    5. rname: domainadmin.eedns.com
    6. serial: 1476072695
    7. refresh: 3600
    8. retry: 900
    9. expire: 86400
    10. minimum-ttl: 3600

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.kqpw.xyz, www.qekqpw.xyz, www.ekqpw.xyz, www.qrkqpw.xyz, www.rkqpw.xyz, www.qvkqpw.xyz, www.vkqpw.xyz, www.qbkqpw.xyz, www.bkqpw.xyz, www.qnkqpw.xyz, www.nkqpw.xyz, www.qfkqpw.xyz, www.fkqpw.xyz, www.qgkqpw.xyz, www.gkqpw.xyz, www.qhkqpw.xyz, www.hkqpw.xyz, www.qykqpw.xyz, www.ykqpw.xyz, www.qqpw.xyz, www.qktqpw.xyz, www.qtqpw.xyz, www.qkqpw.xyz, www.qqpw.xyz, www.qkgqpw.xyz, www.qgqpw.xyz, www.qkbqpw.xyz, www.qbqpw.xyz, www.qknqpw.xyz, www.qnqpw.xyz, www.qkhqpw.xyz, www.qhqpw.xyz, www.qkyqpw.xyz, www.qyqpw.xyz, www.qklqpw.xyz, www.qlqpw.xyz, www.qkoqpw.xyz, www.qoqpw.xyz, www.qkuqpw.xyz, www.quqpw.xyz, www.qkiqpw.xyz, www.qiqpw.xyz, www.qkmqpw.xyz, www.qmqpw.xyz, www.qkpw.xyz, www.qkqepw.xyz, www.qkepw.xyz, www.qkqrpw.xyz, www.qkrpw.xyz, www.qkqvpw.xyz, www.qkvpw.xyz, www.qkqbpw.xyz, www.qkbpw.xyz, www.qkqnpw.xyz, www.qknpw.xyz, www.qkqfpw.xyz, www.qkfpw.xyz, www.qkqgpw.xyz, www.qkgpw.xyz, www.qkqhpw.xyz, www.qkhpw.xyz, www.qkqypw.xyz, www.qkypw.xyz, www.qkqw.xyz, www.qkqpiw.xyz, www.qkqiw.xyz, www.qkqpkw.xyz, www.qkqkw.xyz, www.qkqpuw.xyz, www.qkquw.xyz, www.qkqpjw.xyz, www.qkqjw.xyz, www.qkqplw.xyz, www.qkqlw.xyz, www.qkqp.xyz, www.qkqpw .xyz, www.qkqp .xyz, www.qkqpwc.xyz, www.qkqpc.xyz, www.qkqpw.xyz, www.qkqp.xyz, www.qkqpwd.xyz, www.qkqpd.xyz, www.qkqpwf.xyz, www.qkqpf.xyz, www.qkqpwg.xyz, www.qkqpg.xyz, www.qkqpwb.xyz, www.qkqpb.xyz,

    Other websites we recently analyzed

    1. VARIANTENREICH - VARIANTENREICH
      Reich an Veränderungen. Für Sie persönlich oder für Ihr Unternehmen. Pragmatisch, Praktisch und prägnant. Alles rund um Mensch und Organisation.
      San Francisco (United States) - 199.34.228.69
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
      Number of Javascript: 5
      Number of meta tags: 3
    2. Het Literatuurhuis
      Netherlands - 91.224.248.152
      Server software: Apache
      Technology: CSS, Datepicker, Html, Javascript, Google Analytics, Facebook Box
      Number of Javascript: 11
      Number of meta tags: 1
    3. Vodafone D2 - Privat: Handys, Flatrate, DSL Verträge & mehr - Privat
      Vodafone D2 Privat: Hier bekommen Sie Informationen über Handys, DSL und Flatrate Verträge für den Privatanwender. Erfahren Sie alles über Konditionen, Tarife und Preise der verschiedenen Handy-Modelle, DSL- und Flatrate-Verträge. Vergleichen Sie online Handy-Angebote und finden Sie das Handy Ihrer Wahl mit oder ohne Vertrag. Günstige Flatrate Angebote für Ihren Internet Zugang zu Hause, aber auch Handy-Flatrate Tarife zum günstigen Telefonieren zu jeder Tageszeit zum Mobil- und Festnetz-Anschluss.
      Germany - 46.252.18.102
      Server software: Apache/2.4.20
      Technology: CSS, Html, Javascript, jQuery, Php, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 5
    4. Sgitts | Fashion, Travel, Health & Beauty for the Budget Savvy
      Sgitts | The budget savvy girl who is a lover of life, style, health, travel and new adventures with the habit of over analyzing almost everything.
      Provo (United States) - 66.147.244.94
      G Analytics ID: UA-68662673-1
      Server software: nginx/1.10.0
      Technology: BootstrapCDN, CloudFlare, Google Adsense, CSS, Font Awesome, Google Font API, Gravatar, Html, Javascript, jQuery, Php, Pingback, SVG, Google Analytics, WordPress Stats, Wordpress
      Number of Javascript: 30
      Number of meta tags: 13
    5. Greg Parker - HomeServices Lending, LLC
      San Antonio (United States) - 162.209.72.7
      G Analytics ID: UA-64621401-1
      Server software: Microsoft-IIS/7.5
      Technology: AJAX Libraries API, CSS, Html, Javascript, jQuery, Php, Google Analytics
      Number of Javascript: 5
      Number of meta tags: 1
    6. dreelan.co.uk
      Germany - 217.160.231.245
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    7. Lean Six Sigma Training Courses - Six Sigma Consulting, Recruiting and Software
      Lean Six Sigma Experts Corporation provides comprehensive services for Continuous Improvement initiatives. It provides Lean Six Sigma Training Courses, Consulting, Recruiting and Software Applications.
      Wayne (United States) - 50.21.177.127
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript, Php, Google Analytics
      Number of Javascript: 4
      Number of meta tags: 2
    8. 宝宝时代——海淘爸妈交流论坛 -
      宝宝时代——海淘爸妈交流论坛
      Japan - 106.187.41.247
      Server software: nginx/1.0.10
      Technology: CSS, Html, Javascript, Php, Swf Object, Google Analytics
      Number of Javascript: 4
      Number of meta tags: 10
    9. inktron.org
      Inktron.de Ihr Fachversand für die Produktbereiche Druckerzubehör - Bürobedarf sowie LED-Beleuchtungslösungen der neuesten Generation. Hier finden Sie alles zum Thema LED-Beleuchtung und LED-Zubehör.
      Germany - 85.13.145.210
      Server software: Apache
      Technology: Html
      Number of meta tags: 11
    10. worksafety-jobs.com
      Germany - 89.19.235.153
      Server software: Apache
      Technology: Html

    Check Other Websites